WebID: CYHR1_HUMAN DESCRIPTION: RecName: Full=Cysteine and histidine-rich protein 1; SUBUNIT: Interacts with LGALS3 (By similarity). SUBCELLULAR LOCATION: Cytoplasm (By similarity). Cytoplasm, perinuclear region (By similarity). Note=Shows a prominent perinuclear and cytoplasmic localization (By similarity). SIMILARITY: Belongs to the … WebCYHR1 in human cancer is unknown.16–19 To evaluate the role and significance of CYHR1 in ESCC, we established CYHR1 knock-out esophageal cancer cells by using the small interfering RNA (siRNA) transfection method. Then, we performed a functional analysis, used reverse tran-scription-polymerase chain reaction (RT-PCR) to detect the
BRHR - What does BRHR stand for? The Free Dictionary
WebProtein Description: cysteine/histidine-rich 1 Gene Name: CYHR1 Alternative Gene Name: CHRP, KIAA0496, MGC13010 Sequence: ASSPFPSSQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQ Interspecies mouse/rat: ENSMUSG00000053929: 91%, ENSRNOG00000014811: 91% … rbc accountants
Pre-made anti-CYHR1 monoclonal antibody(mab)-benchmark …
WebIt's the GeneMedi's summary page for Target/Biomarker Introduction of CYHR1. The page also collects GeneMedi's different modalities and formats products for CYHR1 in therapeutics/drug discovery and IVD diagnostics, which is including antibody, ADC, bispecific, antigen, ORF vector, VLP, etc. With GeneMedi's target-insight database-GM … PROTEIN SUMMARY SECTION OVERVIEW RNA DATA ANTIBODY DATA. CYHR1 INFORMATION. Proteini. Full gene name according to HGNC. Cysteine and histidine rich 1. Gene namei. Official gene symbol, which is typically a short form of the gene name, according to HGNC. CYHR1 (CHRP, KIAA0496, MGC13010) Protein classi. WebCYHR1 has 3,540 functional associations with biological entities spanning 8 categories (molecular profile, organism, chemical, functional term, phrase or reference, disease, … sims 3 buy hot tub