Cyhr1

WebID: CYHR1_HUMAN DESCRIPTION: RecName: Full=Cysteine and histidine-rich protein 1; SUBUNIT: Interacts with LGALS3 (By similarity). SUBCELLULAR LOCATION: Cytoplasm (By similarity). Cytoplasm, perinuclear region (By similarity). Note=Shows a prominent perinuclear and cytoplasmic localization (By similarity). SIMILARITY: Belongs to the … WebCYHR1 in human cancer is unknown.16–19 To evaluate the role and significance of CYHR1 in ESCC, we established CYHR1 knock-out esophageal cancer cells by using the small interfering RNA (siRNA) transfection method. Then, we performed a functional analysis, used reverse tran-scription-polymerase chain reaction (RT-PCR) to detect the

BRHR - What does BRHR stand for? The Free Dictionary

WebProtein Description: cysteine/histidine-rich 1 Gene Name: CYHR1 Alternative Gene Name: CHRP, KIAA0496, MGC13010 Sequence: ASSPFPSSQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQ Interspecies mouse/rat: ENSMUSG00000053929: 91%, ENSRNOG00000014811: 91% … rbc accountants https://ugscomedy.com

Pre-made anti-CYHR1 monoclonal antibody(mab)-benchmark …

WebIt's the GeneMedi's summary page for Target/Biomarker Introduction of CYHR1. The page also collects GeneMedi's different modalities and formats products for CYHR1 in therapeutics/drug discovery and IVD diagnostics, which is including antibody, ADC, bispecific, antigen, ORF vector, VLP, etc. With GeneMedi's target-insight database-GM … PROTEIN SUMMARY SECTION OVERVIEW RNA DATA ANTIBODY DATA. CYHR1 INFORMATION. Proteini. Full gene name according to HGNC. Cysteine and histidine rich 1. Gene namei. Official gene symbol, which is typically a short form of the gene name, according to HGNC. CYHR1 (CHRP, KIAA0496, MGC13010) Protein classi. WebCYHR1 has 3,540 functional associations with biological entities spanning 8 categories (molecular profile, organism, chemical, functional term, phrase or reference, disease, … sims 3 buy hot tub

Pharos : Target Details - CYHR1 - National Institutes of Health

Category:lnc-CYHR1-1 Gene - GeneCards lnc-CYHR1-1 RNA Gene

Tags:Cyhr1

Cyhr1

CYHR1: Target/Biomarker Introduction, products summarized …

WebMar 1, 2011 · This CYHR1 fragment is almost as good a predictor of good response (receiver operating characteristic=0.91) as OSMR is a predictor of poor response (receiver operating characteristic=0.98). The current state of knowledge on CYHR1 is limited regarding its predicted protein structure, protein–protein interactions, subcellular … WebCYHR1 Gene - Somatic Mutations in Cancer Actionability v8 is now available for download Gene GRCh38 · COSMIC v97 Gene view The gene view histogram is a graphical view of …

Cyhr1

Did you know?

WebMeaning. CVHR. Cyclic Variation of Heart Rate (cardiology) CVHR. Citizens' Voice for Health Rights (Canada) CVHR. Cardiovasculaire, Hémostase, Respiration (French: … WebHuman diseases caused by Cyhr1 mutations The analysis uses data from IMPC, along with published data on other mouse mutants, in comparison to human disease reports in …

Webse_chr se_start se_end se_id cell_id se_rank se_ele_num se_cas_value se_con_value se_gene_overlap se_gene_proximal se_gene_closest se_gene_prestige se_gene_closest_active se_snp_n WebCysteine/histidine-rich 1 (CYHR1) was first discovered in a yeast two-hybrid screen with murine galectin-3, and no previous reports have described a rela- tionship between the …

WebCYHR1 Alias symbols CHRP, KIAA0496, MGC13010 %HI 61.63(Read more about the DECIPHER Haploinsufficiency Index) pLI 0.49(Read more about gnomAD pLI score) LOEUF 0.53(Read more about gnomAD LOEUF score) Cytoband 8q24.3 Genomic Coordinates. GRCh37/hg19: chr8:145674965-145691084: NCBI Ensembl UCSC: WebInvitrogen Anti-CYHR1 Polyclonal, Catalog # PA5-62823. Tested in Immunocytochemistry (ICC/IF) and Immunohistochemistry (Paraffin) (IHC (P)) applications. This antibody reacts with Human samples. Supplied as 100 µL purified antibody (0.05 mg/mL).

WebDesaki, R., Sawada, G., Okumura, H., Ikeda, R., Tanabe, K., Komatsu, H., … Natsugoe, S. (2015). As a Novel Prognostic Marker, Cysteine/histidine-rich 1 (CYHR1) is a ...

http://www.licpathway.net/sedb/download/new/SE_bed/mm10/SE_12_0592_SE_mm10.bed sims 3 can elders have babiesWebPrEST Antigen CYHR1; Blocking agent and positive assay control using corresponding antibodies. Bulk and Prepack available at Sigmaaldrich.com. US EN. Applications Products Services Support. APREST89884; All Photos (1) APREST89884. PrEST Antigen CYHR1. sims 3 call out from schoolWebCYHR1 CRISPR Knockout and Activation Plasmids (m) designed to edit, knockdown or upregulate mouse CYHR1 gene expression. Choose a Store Santa cruz biotechnology. Santa Cruz Animal Health. Choose a Language English Français 日本語 中文 한글 ... sims 3 bypass launcher steamWebCYHR1 cysteine and histidine rich 1 Location: Also known as: KIAA0496, MGC13010, CHRP Ensembl: ENSG00000187954 NCBI Entrez Gene: 50626 Perturbation Effects … sims 3 can\u0027t login on launcherWebAcronym. Definition. PCHR. Palestinian Centre for Human Rights. PCHR. Personally Controlled Health Record (healthcare) PCHR. Philadelphia Commission on Human … sims 3 buy simpointsWebCYHR1, KIAA0496. Organism names. Organism. Homo sapiens (Human) Taxonomic identifier. 9606 NCBI. Taxonomic lineage. Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo. Accessions. Primary accession. P0DTL6. … rbc acc offerWebHigh CYHR1 expression is associated with Esophageal Squamous Cell Carcinoma. ... rbc account for teens